Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds) |
Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily) 2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology |
Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles) |
Family e.6.1.0: automated matches [227203] (1 protein) not a true family |
Protein automated matches [226934] (20 species) not a true protein |
Species Desulfococcus multivorans [TaxId:897] [225943] (2 PDB entries) |
Domain d3mpib1: 3mpi B:1-231 [213513] Other proteins in same PDB: d3mpia2, d3mpib2, d3mpic2, d3mpid2 automated match to d3mdea2 complexed with fad, gra |
PDB Entry: 3mpi (more details), 2.05 Å
SCOPe Domain Sequences for d3mpib1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mpib1 e.6.1.0 (B:1-231) automated matches {Desulfococcus multivorans [TaxId: 897]} mdfnlskelqmlqkevrnfvnkkivpfadqwdnenhfpyeeavrpmgelgffgtvipeey ggegmdqgwlaamivteeiargssalrvqlnmevlgcaytiltygsealkkkyvpklssa eflggfgitepdagsdvmamsstaedkgdhwllngsktwisnaaqadvliyyaytdkaag srglsafvieprnfpgiktsnleklgshasptgelfldnvkvpkenilgkp
Timeline for d3mpib1: