Class a: All alpha proteins [46456] (289 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel |
Family a.29.3.0: automated matches [227204] (1 protein) not a true family |
Protein automated matches [226935] (26 species) not a true protein |
Species Desulfococcus multivorans [TaxId:897] [225944] (2 PDB entries) |
Domain d3mpia2: 3mpi A:232-389 [213512] Other proteins in same PDB: d3mpia1, d3mpia3, d3mpib1, d3mpib3, d3mpic1, d3mpic3, d3mpid1, d3mpid3 automated match to d3mdea1 complexed with fad, gra |
PDB Entry: 3mpi (more details), 2.05 Å
SCOPe Domain Sequences for d3mpia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mpia2 a.29.3.0 (A:232-389) automated matches {Desulfococcus multivorans [TaxId: 897]} gdgarivfgslnhtrlsaaaggvglaqacldaaikycnerrqfgkpigdfqmnqdmiaqm aveveaarllaykaaaakdegrlnngldvamakyaageavskcanyamrilgaygystey pvarfyrdaptyymvegsanickmiialdqlgvrkanr
Timeline for d3mpia2: