Lineage for d3mpia2 (3mpi A:232-389)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1993780Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1994829Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 1994963Family a.29.3.0: automated matches [227204] (1 protein)
    not a true family
  6. 1994964Protein automated matches [226935] (26 species)
    not a true protein
  7. 1995062Species Desulfococcus multivorans [TaxId:897] [225944] (2 PDB entries)
  8. 1995063Domain d3mpia2: 3mpi A:232-389 [213512]
    Other proteins in same PDB: d3mpia1, d3mpia3, d3mpib1, d3mpib3, d3mpic1, d3mpic3, d3mpid1, d3mpid3
    automated match to d3mdea1
    complexed with fad, gra

Details for d3mpia2

PDB Entry: 3mpi (more details), 2.05 Å

PDB Description: Structure of the glutaryl-coenzyme A dehydrogenase glutaryl-CoA complex
PDB Compounds: (A:) Glutaryl-CoA dehydrogenase

SCOPe Domain Sequences for d3mpia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mpia2 a.29.3.0 (A:232-389) automated matches {Desulfococcus multivorans [TaxId: 897]}
gdgarivfgslnhtrlsaaaggvglaqacldaaikycnerrqfgkpigdfqmnqdmiaqm
aveveaarllaykaaaakdegrlnngldvamakyaageavskcanyamrilgaygystey
pvarfyrdaptyymvegsanickmiialdqlgvrkanr

SCOPe Domain Coordinates for d3mpia2:

Click to download the PDB-style file with coordinates for d3mpia2.
(The format of our PDB-style files is described here.)

Timeline for d3mpia2: