SCOPe 2.08: Domain d3mo1a2: 3mo1 A:108-211

Lineage for d3mo1a2 (3mo1 A:108-211)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d3mo1a2: 3mo1 A:108-211 [213494]
   automated match to d1dqdl2
   complexed with act, so4

Details for d3mo1a2

PDB Entry: 3mo1, 1.8 Å

PDB Description: Crystal structure of the non-neutralizing HIV antibody 13H11 Fab fragment

PDB Compounds: (A:) anti-hiv-1 antibody 13h11 light chain

SCOPe Domain Sequences for d3mo1a2:

Sequence; same for both SEQRES and ATOM records:

>d3mo1a2 b.1.1.0 (A:108-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

Timeline for d3mo1a2:

• d3mo1a2 first appeared in SCOPe 2.03
  
• d3mo1a2 appears in SCOPe 2.07