SCOPe 2.08: Domain d3mnvc1: 3mnv C:-1-107

Lineage for d3mnvc1 (3mnv C:-1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d3mnvc1: 3mnv C:-1-107 [213491]
   automated match to d1dqdl1
   complexed with cl, edo, no3, so4

Details for d3mnvc1

PDB Entry: 3mnv, 2.4 Å

PDB Description: crystal structure of the non-neutralizing hiv antibody 13h11 fab fragment

PDB Compounds: (C:) anti-hiv-1 antibody 13h11 light chain

SCOPe Domain Sequences for d3mnvc1:

Sequence; same for both SEQRES and ATOM records:

>d3mnvc1 b.1.1.0 (C:-1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rldiqltqspsslamsggqkvtmrckssqsllnsrnernylawyqqkpgqspkllvyfas
iresgvpdrfigsgsgtdftltissvqaedladyfclqhyntpwtfgggtkleik

Timeline for d3mnvc1:

• d3mnvc1 first appeared in SCOPe 2.03
  
• d3mnvc1 appears in SCOPe 2.07