Lineage for d3mnva1 (3mnv A:-1-107)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1520466Species Mouse (Mus musculus) [TaxId:10090] [188198] (388 PDB entries)
  8. 1520707Domain d3mnva1: 3mnv A:-1-107 [213489]
    automated match to d1dqdl1
    complexed with cl, edo, no3, so4

Details for d3mnva1

PDB Entry: 3mnv (more details), 2.4 Å

PDB Description: crystal structure of the non-neutralizing hiv antibody 13h11 fab fragment
PDB Compounds: (A:) anti-hiv-1 antibody 13h11 light chain

SCOPe Domain Sequences for d3mnva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mnva1 b.1.1.0 (A:-1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rldiqltqspsslamsggqkvtmrckssqsllnsrnernylawyqqkpgqspkllvyfas
iresgvpdrfigsgsgtdftltissvqaedladyfclqhyntpwtfgggtkleik

SCOPe Domain Coordinates for d3mnva1:

Click to download the PDB-style file with coordinates for d3mnva1.
(The format of our PDB-style files is described here.)

Timeline for d3mnva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3mnva2