Lineage for d2mpal2 (2mpa L:113-219)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 8568Species Bactericidal Fab MN12H2, (mouse), kappa L chain [49084] (2 PDB entries)
  8. 8570Domain d2mpal2: 2mpa L:113-219 [21348]
    Other proteins in same PDB: d2mpah1, d2mpal1

Details for d2mpal2

PDB Entry: 2mpa (more details), 2.6 Å

PDB Description: bactericidal antibody against neisseria meningitidis

SCOP Domain Sequences for d2mpal2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mpal2 b.1.1.2 (L:113-219) Immunoglobulin (constant domains of L and H chains) {Bactericidal Fab MN12H2, (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d2mpal2:

Click to download the PDB-style file with coordinates for d2mpal2.
(The format of our PDB-style files is described here.)

Timeline for d2mpal2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2mpal1