Lineage for d2f58h2 (2f58 H:114-230)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655111Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 655348Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)
  8. 655619Domain d2f58h2: 2f58 H:114-230 [21347]
    Other proteins in same PDB: d2f58h1, d2f58l1, d2f58l2
    part of anti-gp120 (HIV-1) Fab 58.2
    complexed with arn

Details for d2f58h2

PDB Entry: 2f58 (more details), 2.8 Å

PDB Description: igg1 fab fragment (58.2) complex with 12-residue cyclic peptide (including residues 315-324 of hiv-1 gp120) (mn isolate)
PDB Compounds: (H:) protein (igg1 fab 58.2 antibody (heavy chaiin))

SCOP Domain Sequences for d2f58h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f58h2 b.1.1.2 (H:114-230) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpssprpsetvtcnvahpasstkvdkkivprdc

SCOP Domain Coordinates for d2f58h2:

Click to download the PDB-style file with coordinates for d2f58h2.
(The format of our PDB-style files is described here.)

Timeline for d2f58h2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2f58h1