Lineage for d2f58h2 (2f58 H:114-230)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 220946Species Anti-gp120 (HIV-1) Fab 58.2, (mouse), kappa L chain [49083] (3 PDB entries)
  8. 220951Domain d2f58h2: 2f58 H:114-230 [21347]
    Other proteins in same PDB: d2f58h1, d2f58l1
    complexed with arn

Details for d2f58h2

PDB Entry: 2f58 (more details), 2.8 Å

PDB Description: igg1 fab fragment (58.2) complex with 12-residue cyclic peptide (including residues 315-324 of hiv-1 gp120) (mn isolate)

SCOP Domain Sequences for d2f58h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f58h2 b.1.1.2 (H:114-230) Immunoglobulin (constant domains of L and H chains) {Anti-gp120 (HIV-1) Fab 58.2, (mouse), kappa L chain}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpssprpsetvtcnvahpasstkvdkkivprdc

SCOP Domain Coordinates for d2f58h2:

Click to download the PDB-style file with coordinates for d2f58h2.
(The format of our PDB-style files is described here.)

Timeline for d2f58h2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2f58h1