![]() | Class b: All beta proteins [48724] (93 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
![]() | Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species) |
![]() | Species Anti-gp120 (HIV-1) Fab 58.2, (mouse), kappa L chain [49083] (3 PDB entries) |
![]() | Domain d2f58h2: 2f58 H:114-230 [21347] Other proteins in same PDB: d2f58h1, d2f58l1 |
PDB Entry: 2f58 (more details), 2.8 Å
SCOP Domain Sequences for d2f58h2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f58h2 b.1.1.2 (H:114-230) Immunoglobulin (constant domains of L and H chains) {Anti-gp120 (HIV-1) Fab 58.2, (mouse), kappa L chain} akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd lytlsssvtvpssprpsetvtcnvahpasstkvdkkivprdc
Timeline for d2f58h2: