SCOPe 2.08: Domain d3mn1f1: 3mn1 F:7-179

Lineage for d3mn1f1 (3mn1 F:7-179)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.0: automated matches [191369] (1 protein)
   not a true family

6. Protein automated matches [190447] (55 species)
   not a true protein

7. Species Pseudomonas syringae [TaxId:264730] [196431] (2 PDB entries)

8. Domain d3mn1f1: 3mn1 F:7-179 [213469]
   Other proteins in same PDB: d3mn1a2, d3mn1a3, d3mn1b2, d3mn1c2, d3mn1d2, d3mn1e2, d3mn1f2, d3mn1g2, d3mn1h2, d3mn1i2, d3mn1j2, d3mn1k2, d3mn1l2
   automated match to d3nrjl_
   complexed with cl

Details for d3mn1f1

PDB Entry: 3mn1, 1.8 Å

PDB Description: crystal structure of probable yrbi family phosphatase from pseudomonas syringae pv.phaseolica 1448a

PDB Compounds: (F:) probable yrbi family phosphatase

SCOPe Domain Sequences for d3mn1f1:

Sequence; same for both SEQRES and ATOM records:

>d3mn1f1 c.108.1.0 (F:7-179) automated matches {Pseudomonas syringae [TaxId: 264730]}
sqdlmqrgkaiklavfdvdgvltdgrlyfmedgseiktfntldgqgikmliasgvttaii
sgrktaiverrakslgiehlfqgredklvvldkllaelqlgyeqvaylgddlpdlpvirr
vglgmavanaasfvrehahgitraqggegaarefcelilsaqgnleaahsvyl

Timeline for d3mn1f1:

• d3mn1f1 first appeared in SCOPe 2.03, called d3mn1f_
  
• d3mn1f1 appears in SCOPe 2.07