Class b: All beta proteins [48724] (144 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88567] (277 PDB entries) |
Domain d3f58l2: 3f58 L:108-211 [21344] Other proteins in same PDB: d3f58h1, d3f58h2, d3f58l1 part of anti-gp120 (HIV-1) Fab 58.2 |
PDB Entry: 3f58 (more details), 2.8 Å
SCOP Domain Sequences for d3f58l2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3f58l2 b.1.1.2 (L:108-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnr
Timeline for d3f58l2: