Lineage for d3f58l2 (3f58 L:108-211)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 365639Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 365760Species Mouse (Mus musculus) [TaxId:10090] [88567] (270 PDB entries)
  8. 365969Domain d3f58l2: 3f58 L:108-211 [21344]
    Other proteins in same PDB: d3f58h1, d3f58h2, d3f58l1
    part of anti-gp120 (HIV-1) Fab 58.2
    mutant

Details for d3f58l2

PDB Entry: 3f58 (more details), 2.8 Å

PDB Description: igg1 fab fragment (58.2) complex with 12-residue cyclic peptide (including residues 315-324 of hiv-1 gp120 (mn isolate); h315s mutation

SCOP Domain Sequences for d3f58l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f58l2 b.1.1.2 (L:108-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOP Domain Coordinates for d3f58l2:

Click to download the PDB-style file with coordinates for d3f58l2.
(The format of our PDB-style files is described here.)

Timeline for d3f58l2:

Domains from same chain:
(mouse over for more information)
d3f58l1
Domains from other chains:
(mouse over for more information)
d3f58h1, d3f58h2