SCOP 1.63: Domain d1f58h2: 1f58 H:114-230

Lineage for d1f58h2 (1f58 H:114-230)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)

7. Species Anti-gp120 (HIV-1) Fab 58.2, (mouse), kappa L chain [49083] (3 PDB entries)

8. Domain d1f58h2: 1f58 H:114-230 [21343]
   Other proteins in same PDB: d1f58h1, d1f58l1
   mutant

Details for d1f58h2

PDB Entry: 1f58, 2 Å

PDB Description: igg1 fab fragment (58.2) complex with 24-residue peptide (residues 308-333 of hiv-1 gp120 (mn isolate) with ala to aib substitution at position 323

SCOP Domain Sequences for d1f58h2:

Sequence; same for both SEQRES and ATOM records:

>d1f58h2 b.1.1.2 (H:114-230) Immunoglobulin (constant domains of L and H chains) {Anti-gp120 (HIV-1) Fab 58.2, (mouse), kappa L chain}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpssprpsetvtcnvahpasstkvdkkivprdc

Timeline for d1f58h2:

• d1f58h2 first appeared (with stable ids) in SCOP 1.55
  
• d1f58h2 appears in SCOP 1.61
  
• d1f58h2 appears in SCOP 1.65
  
• d1f58h2 appears in the current release, SCOPe 2.08