Lineage for d1cfnb2 (1cfn B:113-213)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 159225Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)
  7. 159366Species Anti-p24 (HIV-1) Fab CB 4-1 (mouse), kappa L chain [49082] (8 PDB entries)
  8. 159380Domain d1cfnb2: 1cfn B:113-213 [21341]
    Other proteins in same PDB: d1cfna1, d1cfnb1

Details for d1cfnb2

PDB Entry: 1cfn (more details), 2.65 Å

PDB Description: anti-p24 (hiv-1) fab fragment cb41 complexed with an epitope-related peptide

SCOP Domain Sequences for d1cfnb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cfnb2 b.1.1.2 (B:113-213) Immunoglobulin (constant domains of L and H chains) {Anti-p24 (HIV-1) Fab CB 4-1 (mouse), kappa L chain}
akttapsvyplvpvcggttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpallqsg
lytlsssvtvtsntwpsqtitcnvahpasstkvdkkieprv

SCOP Domain Coordinates for d1cfnb2:

Click to download the PDB-style file with coordinates for d1cfnb2.
(The format of our PDB-style files is described here.)

Timeline for d1cfnb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cfnb1