Lineage for d1hh9b2 (1hh9 B:113-213)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655111Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 655348Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)
  8. 655713Domain d1hh9b2: 1hh9 B:113-213 [21339]
    Other proteins in same PDB: d1hh9a1, d1hh9a2, d1hh9b1
    part of anti-gp120 (HIV-1) Fab CB 4-1
    complexed with nh2

Details for d1hh9b2

PDB Entry: 1hh9 (more details), 2.7 Å

PDB Description: anti-p24 (hiv-1) fab fragment cb41 complexed with a peptide
PDB Compounds: (B:) igg2a kappa antibody cb41 (heavy chain)

SCOP Domain Sequences for d1hh9b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hh9b2 b.1.1.2 (B:113-213) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttapsvyplvpvcggttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpallqsg
lytlsssvtvtsntwpsqtitcnvahpasstkvdkkieprv

SCOP Domain Coordinates for d1hh9b2:

Click to download the PDB-style file with coordinates for d1hh9b2.
(The format of our PDB-style files is described here.)

Timeline for d1hh9b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hh9b1