Lineage for d1cftb2 (1cft B:113-213)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 8527Species Anti-p24 (HIV-1) Fab CB 4-1 (mouse), kappa L chain [49082] (8 PDB entries)
  8. 8537Domain d1cftb2: 1cft B:113-213 [21337]
    Other proteins in same PDB: d1cfta1, d1cftb1

Details for d1cftb2

PDB Entry: 1cft (more details), 2.8 Å

PDB Description: anti-p24 (hiv-1) fab fragment cb41 complexed with an epitope-unrelated d-peptide

SCOP Domain Sequences for d1cftb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cftb2 b.1.1.2 (B:113-213) Immunoglobulin (constant domains of L and H chains) {Anti-p24 (HIV-1) Fab CB 4-1 (mouse), kappa L chain}
akttapsvyplvpvcggttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpallqsg
lytlsssvtvtsntwpsqtitcnvahpasstkvdkkieprv

SCOP Domain Coordinates for d1cftb2:

Click to download the PDB-style file with coordinates for d1cftb2.
(The format of our PDB-style files is described here.)

Timeline for d1cftb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cftb1