Lineage for d3mlxm1 (3mlx M:2-108)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1765207Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)
  8. 1765339Domain d3mlxm1: 3mlx M:2-108 [213358]
    Other proteins in same PDB: d3mlxl2, d3mlxm2
    automated match to d1q1jl1

Details for d3mlxm1

PDB Entry: 3mlx (more details), 1.9 Å

PDB Description: crystal structure of anti-hiv-1 v3 fab 3074 in complex with an mn v3 peptide
PDB Compounds: (M:) Human monoclonal anti-HIV-1 gp120 V3 antibody 3074 Fab light chain

SCOPe Domain Sequences for d3mlxm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mlxm1 b.1.1.0 (M:2-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svltqppsvsaapgqkvtiscsgsssnignnmvswyqqhpgtapklliyenskrpsgipd
rfsgsrsgtsatlgiiglqtgdeaeyycatwdgslrtvfgggtkltvlsq

SCOPe Domain Coordinates for d3mlxm1:

Click to download the PDB-style file with coordinates for d3mlxm1.
(The format of our PDB-style files is described here.)

Timeline for d3mlxm1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3mlxm2