SCOPe 2.04: Domain d3mlvl1: 3mlv L:2-112

Lineage for d3mlvl1 (3mlv L:2-112)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)

8. Domain d3mlvl1: 3mlv L:2-112 [213348]
   Other proteins in same PDB: d3mlvl2, d3mlvm2
   automated match to d1q1jl1

Details for d3mlvl1

PDB Entry: 3mlv, 2.48 Å

PDB Description: crystal structure of anti-hiv-1 v3 fab 2557 in complex with an nof v3 peptide

PDB Compounds: (L:) Human monoclonal anti-HIV-1 gp120 V3 antibody 2557 Fab light chain

SCOPe Domain Sequences for d3mlvl1:

Sequence; same for both SEQRES and ATOM records:

>d3mlvl1 b.1.1.0 (L:2-112) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ylltqppsvsvspgqtasiscsgdklddkyvswyyqrpgqspvllmyqdfkrpsgiperl
sgsksgktatltisgtqsldegdyycqawdastgvsgggtkltvlfgegtrltvlaq

Timeline for d3mlvl1:

• d3mlvl1 first appeared in SCOPe 2.03
  
• d3mlvl1 appears in SCOPe 2.05
  
• d3mlvl1 appears in the current release, SCOPe 2.08