SCOP 1.55: Domain d1hh6a2: 1hh6 A:108-214

Lineage for d1hh6a2 (1hh6 A:108-214)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)

7. Species Anti-p24 (HIV-1) Fab CB 4-1 (mouse), kappa L chain [49082] (8 PDB entries)

8. Domain d1hh6a2: 1hh6 A:108-214 [21334]
   Other proteins in same PDB: d1hh6a1, d1hh6b1

Details for d1hh6a2

PDB Entry: 1hh6, 2.6 Å

PDB Description: anti-p24 (hiv-1) fab fragment cb41 complexed with a peptide

SCOP Domain Sequences for d1hh6a2:

Sequence; same for both SEQRES and ATOM records:

>d1hh6a2 b.1.1.2 (A:108-214) Immunoglobulin (constant domains of L and H chains) {Anti-p24 (HIV-1) Fab CB 4-1 (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkeinvkwkidgserqngvldswteqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d1hh6a2:

• d1hh6a2 appears in SCOP 1.57
  
• d1hh6a2 appears in the current release, SCOPe 2.08