Lineage for d3mlta1 (3mlt A:1-111)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1765207Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)
  8. 1765805Domain d3mlta1: 3mlt A:1-111 [213338]
    Other proteins in same PDB: d3mlta2, d3mltd2, d3mltg2, d3mltl2
    automated match to d2dd8l1

Details for d3mlta1

PDB Entry: 3mlt (more details), 2.49 Å

PDB Description: crystal structure of anti-hiv-1 v3 fab 2557 in complex with a ug1033 v3 peptide
PDB Compounds: (A:) Human monoclonal anti-HIV-1 gp120 V3 antibody 2557 Fab light chain

SCOPe Domain Sequences for d3mlta1:

Sequence, based on SEQRES records: (download)

>d3mlta1 b.1.1.0 (A:1-111) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sydltqppsvsvspgqtasiscsgdklddkyvswyyqrpgqspvllmyqdfkrpsgiper
lsgsksgktatltisgtqsldegdyycqawdastgvsgggtkltvlfgdgtrltvlg

Sequence, based on observed residues (ATOM records): (download)

>d3mlta1 b.1.1.0 (A:1-111) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sydltqppsvsvspgqtasiscsgdklddkyvswyyqrpgqspvllmyqdfkrpsgiper
lsgsksgktatltisgtqsldegdyycqawdastggtkltvlfgdgtrltvlg

SCOPe Domain Coordinates for d3mlta1:

Click to download the PDB-style file with coordinates for d3mlta1.
(The format of our PDB-style files is described here.)

Timeline for d3mlta1: