SCOPe 2.04: Domain d3mlsn2: 3mls N:112-213

Lineage for d3mlsn2 (3mls N:112-213)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries)

8. Domain d3mlsn2: 3mls N:112-213 [213335]
   Other proteins in same PDB: d3mlsl1, d3mlsm1, d3mlsn1, d3mlso1
   automated match to d2dd8l2

Details for d3mlsn2

PDB Entry: 3mls, 2.5 Å

PDB Description: crystal structure of anti-hiv-1 v3 mab 2557 fab in complex with a hiv- 1 gp120 v3 mimotope

PDB Compounds: (N:) Human monoclonal anti-HIV-1 gp120 V3 antibody 2557 Fab light chain

SCOPe Domain Sequences for d3mlsn2:

Sequence; same for both SEQRES and ATOM records:

>d3mlsn2 b.1.1.2 (N:112-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshksyscqvthegstvektvapt

Timeline for d3mlsn2:

• d3mlsn2 first appeared in SCOPe 2.03
  
• d3mlsn2 appears in SCOPe 2.05
  
• d3mlsn2 appears in the current release, SCOPe 2.08