Lineage for d1cfsb2 (1cfs B:113-213)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 103279Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 103650Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)
  7. 103764Species Anti-p24 (HIV-1) Fab CB 4-1 (mouse), kappa L chain [49082] (8 PDB entries)
  8. 103772Domain d1cfsb2: 1cfs B:113-213 [21333]
    Other proteins in same PDB: d1cfsa1, d1cfsb1

Details for d1cfsb2

PDB Entry: 1cfs (more details), 2.75 Å

PDB Description: anti-p24 (hiv-1) fab fragment cb41 complexed with an epitope-unrelated peptide

SCOP Domain Sequences for d1cfsb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cfsb2 b.1.1.2 (B:113-213) Immunoglobulin (constant domains of L and H chains) {Anti-p24 (HIV-1) Fab CB 4-1 (mouse), kappa L chain}
akttapsvyplvpvcggttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpallqsg
lytlsssvtvtsntwpsqtitcnvahpasstkvdkkieprv

SCOP Domain Coordinates for d1cfsb2:

Click to download the PDB-style file with coordinates for d1cfsb2.
(The format of our PDB-style files is described here.)

Timeline for d1cfsb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cfsb1