SCOPe 2.08: Domain d3mjdd1: 3mjd D:0-208

Lineage for d3mjdd1 (3mjd D:0-208)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.0: automated matches [191528] (1 protein)
   not a true family

6. Protein automated matches [190891] (38 species)
   not a true protein

7. Species Francisella tularensis [TaxId:119856] [225884] (1 PDB entry)

8. Domain d3mjdd1: 3mjd D:0-208 [213284]
   Other proteins in same PDB: d3mjda2, d3mjdb2, d3mjdc2, d3mjdd2
   automated match to d2ps1a_
   complexed with edo, trs

Details for d3mjdd1

PDB Entry: 3mjd, 1.9 Å

PDB Description: 1.9 angstrom crystal structure of orotate phosphoribosyltransferase (pyre) francisella tularensis.

PDB Compounds: (D:) orotate phosphoribosyltransferase

SCOPe Domain Sequences for d3mjdd1:

Sequence, based on SEQRES records:

>d3mjdd1 c.61.1.0 (D:0-208) automated matches {Francisella tularensis [TaxId: 119856]}
amfiefalknqvlkfgeftlksgrispyffnaglfntgaqlatladyyaqliiksdvkyd
ilfgpaykgiplvaaistvlalkynidmpyafdrkeakdhgeggvfvgadmtnkkvllid
dvmtagtafyesynklkiinakiagvvlsidrqekakdsdisatkkisqdfnipvlavtn
fesifeyvkenldetmidkfkqyrqkygs

Sequence, based on observed residues (ATOM records):

>d3mjdd1 c.61.1.0 (D:0-208) automated matches {Francisella tularensis [TaxId: 119856]}
amfiefalknqvlkfgeftlksgrispyffnaglfntgaqlatladyyaqliiksdvkyd
ilfgpaykgiplvaaistvlalkynidmpyafdrkegvfvgadmtnkkvlliddvmtagt
afyesynklkiinakiagvvlsidrqekakdsdisatkkisqdfnipvlavtnfesifey
vkenldetmidkfkqyrqkygs

Timeline for d3mjdd1:

• d3mjdd1 first appeared in SCOPe 2.03, called d3mjdd_
  
• d3mjdd1 appears in SCOPe 2.07