Lineage for d3mj9l2 (3mj9 L:108-212)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1764937Species Cricetulus migratorius [TaxId:10032] [225940] (5 PDB entries)
  8. 1764955Domain d3mj9l2: 3mj9 L:108-212 [213280]
    automated match to d1adql2
    complexed with nag

Details for d3mj9l2

PDB Entry: 3mj9 (more details), 2.95 Å

PDB Description: crystal structure of jaml in complex with the stimulatory antibody hl4e10
PDB Compounds: (L:) stimulatory hamster antibody hl4e10 fab light chain

SCOPe Domain Sequences for d3mj9l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mj9l2 b.1.1.0 (L:108-212) automated matches {Cricetulus migratorius [TaxId: 10032]}
qpnaapsvtlfppsseelktnqatlvcmingfypadvavtweadgtpitqgvkttqpsks
dskymatsyltmtadawksrntfickvthggntvekslsps

SCOPe Domain Coordinates for d3mj9l2:

Click to download the PDB-style file with coordinates for d3mj9l2.
(The format of our PDB-style files is described here.)

Timeline for d3mj9l2: