SCOP 1.59: Domain d1bogb2: 1bog B:113-213

Lineage for d1bogb2 (1bog B:113-213)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)

7. Species Anti-p24 (HIV-1) Fab CB 4-1 (mouse), kappa L chain [49082] (8 PDB entries)

8. Domain d1bogb2: 1bog B:113-213 [21327]
   Other proteins in same PDB: d1boga1, d1bogb1

Details for d1bogb2

PDB Entry: 1bog, 2.6 Å

PDB Description: anti-p24 (hiv-1) fab fragment cb41 complexed with an epitope-homologous peptide

SCOP Domain Sequences for d1bogb2:

Sequence; same for both SEQRES and ATOM records:

>d1bogb2 b.1.1.2 (B:113-213) Immunoglobulin (constant domains of L and H chains) {Anti-p24 (HIV-1) Fab CB 4-1 (mouse), kappa L chain}
akttapsvyplvpvcggttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpallqsg
lytlsssvtvtsntwpsqtitcnvahpasstkvdkkieprv

Timeline for d1bogb2:

• d1bogb2 first appeared (with stable ids) in SCOP 1.55
  
• d1bogb2 appears in SCOP 1.57
  
• d1bogb2 appears in SCOP 1.61
  
• d1bogb2 appears in the current release, SCOPe 2.08