Lineage for d3mi9b2 (3mi9 B:151-261)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2003386Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2003387Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2003956Family a.74.1.0: automated matches [227298] (1 protein)
    not a true family
  6. 2003957Protein automated matches [227124] (1 species)
    not a true protein
  7. 2003958Species Human (Homo sapiens) [TaxId:9606] [226765] (8 PDB entries)
  8. 2003960Domain d3mi9b2: 3mi9 B:151-261 [213264]
    Other proteins in same PDB: d3mi9a_
    automated match to d2ivxa2
    complexed with zn

Details for d3mi9b2

PDB Entry: 3mi9 (more details), 2.1 Å

PDB Description: Crystal structure of HIV-1 Tat complexed with human P-TEFb
PDB Compounds: (B:) Cyclin-T1

SCOPe Domain Sequences for d3mi9b2:

Sequence, based on SEQRES records: (download)

>d3mi9b2 a.74.1.0 (B:151-261) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dhphthvvkctqlvraskdlaqtsyfmatnslhlttfslqytppvvacvcihlackwsnw
eipvstdgkhwweyvdatvtlelldeltheflqilektpnrlkriwnwrac

Sequence, based on observed residues (ATOM records): (download)

>d3mi9b2 a.74.1.0 (B:151-261) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dhphthvvkctqlvraskdlaqtsyfmatnslhlttfslqytppvvacvcihlackwsnw
eipvstdgkhwweyvdatvtlelldeltheflqilektpnrlc

SCOPe Domain Coordinates for d3mi9b2:

Click to download the PDB-style file with coordinates for d3mi9b2.
(The format of our PDB-style files is described here.)

Timeline for d3mi9b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3mi9b1
View in 3D
Domains from other chains:
(mouse over for more information)
d3mi9a_