Lineage for d3mi9a_ (3mi9 A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2542919Protein Cell division protein kinase 9, CDK9 [160810] (1 species)
  7. 2542920Species Human (Homo sapiens) [TaxId:9606] [160811] (6 PDB entries)
    Uniprot P50750 8-325
  8. 2542921Domain d3mi9a_: 3mi9 A: [213262]
    Other proteins in same PDB: d3mi9b1, d3mi9b2
    automated match to d3my1a_
    complexed with zn

Details for d3mi9a_

PDB Entry: 3mi9 (more details), 2.1 Å

PDB Description: Crystal structure of HIV-1 Tat complexed with human P-TEFb
PDB Compounds: (A:) Cell division protein kinase 9

SCOPe Domain Sequences for d3mi9a_:

Sequence, based on SEQRES records: (download)

>d3mi9a_ d.144.1.7 (A:) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]}
vecpfcdevskyeklakigqgtfgevfkarhrktgqkvalkkvlmenekegfpitalrei
kilqllkhenvvnlieicrtkaspynrckgsiylvfdfcehdlagllsnvlvkftlseik
rvmqmllnglyyihrnkilhrdmkaanvlitrdgvlkladfglarafslaknsqpnrytn
rvvtlwyrppelllgerdygppidlwgagcimaemwtrspimqgnteqhqlalisqlcgs
itpevwpnvdnyelyeklelvkgqkrkvkdrlkayvrdpyaldlidkllvldpaqridsd
dalnhdffwsdpmpsdlkgmlsthltsmfeylapprr

Sequence, based on observed residues (ATOM records): (download)

>d3mi9a_ d.144.1.7 (A:) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]}
vecpfcdevskyeklakigqgtfgevfkarhrktgqkvalkkvlmenekegfpitalrei
kilqllkhenvvnlieicrtkgsiylvfdfcehdlagllsnvlvkftlseikrvmqmlln
glyyihrnkilhrdmkaanvlitrdgvlkladfglarafslaknsqpnrytnrvvtlwyr
ppelllgerdygppidlwgagcimaemwtrspimqgnteqhqlalisqlcgsitpevwpn
vdnyelyeklelvkgqkrkvkdrlkayvrdpyaldlidkllvldpaqridsddalnhdff
wsdpmpsdlkgmlsthltsmfeylapprr

SCOPe Domain Coordinates for d3mi9a_:

Click to download the PDB-style file with coordinates for d3mi9a_.
(The format of our PDB-style files is described here.)

Timeline for d3mi9a_: