SCOP 1.55: Domain d1blnd2: 1bln D:114-227

Lineage for d1blnd2 (1bln D:114-227)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)

7. Species Anti-p-glycoprotein Fab MRK-16 (mouse), kappa L chain [49081] (1 PDB entry)

8. Domain d1blnd2: 1bln D:114-227 [21325]
   Other proteins in same PDB: d1blna1, d1blnb1, d1blnc1, d1blnd1

Details for d1blnd2

PDB Entry: 1bln, 2.8 Å

PDB Description: anti-p-glycoprotein fab mrk-16

SCOP Domain Sequences for d1blnd2:

Sequence; same for both SEQRES and ATOM records:

>d1blnd2 b.1.1.2 (D:114-227) Immunoglobulin (constant domains of L and H chains) {Anti-p-glycoprotein Fab MRK-16 (mouse), kappa L chain}
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdkkiep

Timeline for d1blnd2:

• d1blnd2 appears in SCOP 1.57
  
• d1blnd2 appears in the current release, SCOPe 2.08