SCOPe 2.04: Domain d3mg3a2: 3mg3 A:174-312

Lineage for d3mg3a2 (3mg3 A:174-312)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.0: automated matches [191337] (1 protein)
   not a true family

6. Protein automated matches [190205] (19 species)
   not a true protein

7. Species Synechocystis sp. [TaxId:1148] [225878] (3 PDB entries)

8. Domain d3mg3a2: 3mg3 A:174-312 [213246]
   Other proteins in same PDB: d3mg3a1, d3mg3b1
   automated match to d1m98a2
   complexed with ech, gol; mutant

Details for d3mg3a2

PDB Entry: 3mg3, 1.7 Å

PDB Description: crystal structure of the orange carotenoid protein r155l mutant from cyanobacteria synechocystis sp. pcc 6803

PDB Compounds: (A:) Orange carotenoid-binding protein

SCOPe Domain Sequences for d3mg3a2:

Sequence; same for both SEQRES and ATOM records:

>d3mg3a2 d.17.4.0 (A:174-312) automated matches {Synechocystis sp. [TaxId: 1148]}
epvvppqdtasrtkvsiegvtnatvlnymdnlnandfdtlielftsdgalqppfqrpivg
kenvlrffreecqnlklipergvtepaedgftqikvtgkvqtpwfggnvgmniawrflln
pegkiffvaidllaspkel

Timeline for d3mg3a2:

• d3mg3a2 first appeared in SCOPe 2.03
  
• d3mg3a2 appears in SCOPe 2.05
  
• d3mg3a2 appears in the current release, SCOPe 2.08