![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
![]() | Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries) |
![]() | Domain d1blnc2: 1bln C:108-214 [21324] Other proteins in same PDB: d1blna1, d1blnb1, d1blnb2, d1blnc1, d1blnd1, d1blnd2 part of anti-P-glycoprotein Fab MRK-16 |
PDB Entry: 1bln (more details), 2.8 Å
SCOP Domain Sequences for d1blnc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1blnc2 b.1.1.2 (C:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceatspivksfnrnec
Timeline for d1blnc2: