SCOPe 2.04: Domain d3mg1b1: 3mg1 B:3-173

Lineage for d3mg1b1 (3mg1 B:3-173)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.175: Orange carotenoid protein, N-terminal domain [81929] (1 superfamily)
   multihelical; array

4. Superfamily a.175.1: Orange carotenoid protein, N-terminal domain [81930] (1 family)
   duplication: contains four structural repeats arranged into two intertwined 4-helical subdomains
   automatically mapped to Pfam PF09150

5. Family a.175.1.1: Orange carotenoid protein, N-terminal domain [81931] (2 proteins)

6. Protein automated matches [227037] (1 species)
   not a true protein

7. Species Synechocystis sp. [TaxId:1148] [225877] (3 PDB entries)

8. Domain d3mg1b1: 3mg1 B:3-173 [213239]
   Other proteins in same PDB: d3mg1a2, d3mg1b2
   automated match to d1m98a1
   complexed with ech, gol

Details for d3mg1b1

PDB Entry: 3mg1, 1.65 Å

PDB Description: crystal structure of the orange carotenoid protein from cyanobacteria synechocystis sp. pcc 6803

PDB Compounds: (B:) Orange Carotenoid Protein

SCOPe Domain Sequences for d3mg1b1:

Sequence, based on SEQRES records:

>d3mg1b1 a.175.1.1 (B:3-173) automated matches {Synechocystis sp. [TaxId: 1148]}
ftidsargifpntlaadvvpatiarfsqlnaedqlaliwfaylemgktltiaapgaasmq
laenalkeiqamgplqqtqamcdlanradtplcrtyaswspniklgfwyrlgelmeqgfv
apipagyqlsananavlatiqglesgqqitvlrnavvdmgftagkdgkria

Sequence, based on observed residues (ATOM records):

>d3mg1b1 a.175.1.1 (B:3-173) automated matches {Synechocystis sp. [TaxId: 1148]}
ftidsargifpntlaadvvpatiarfsqlnaedqlaliwfaylemgktltiaapgaasmq
laenalkeiqamgplqqtqamcdlanradtplcrtyaswspniklgfwyrlgelmeqgfv
apipagyqlsananavlatiqglesgqqitvlrnavvdmgftria

Timeline for d3mg1b1:

• d3mg1b1 first appeared in SCOPe 2.03
  
• d3mg1b1 appears in SCOPe 2.05
  
• d3mg1b1 appears in the current release, SCOPe 2.08