SCOPe 2.08: Domain d3mg1a2: 3mg1 A:174-311

Lineage for d3mg1a2 (3mg1 A:174-311)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.0: automated matches [191337] (1 protein)
   not a true family

6. Protein automated matches [190205] (35 species)
   not a true protein

7. Species Synechocystis sp. [TaxId:1148] [225878] (8 PDB entries)

8. Domain d3mg1a2: 3mg1 A:174-311 [213238]
   Other proteins in same PDB: d3mg1a1, d3mg1b1
   automated match to d1m98a2
   complexed with ech, gol

Details for d3mg1a2

PDB Entry: 3mg1, 1.65 Å

PDB Description: crystal structure of the orange carotenoid protein from cyanobacteria synechocystis sp. pcc 6803

PDB Compounds: (A:) Orange Carotenoid Protein

SCOPe Domain Sequences for d3mg1a2:

Sequence; same for both SEQRES and ATOM records:

>d3mg1a2 d.17.4.0 (A:174-311) automated matches {Synechocystis sp. [TaxId: 1148]}
epvvppqdtasrtkvsiegvtnatvlnymdnlnandfdtlielftsdgalqppfqrpivg
kenvlrffreecqnlklipergvtepaedgftqikvtgkvqtpwfggnvgmniawrflln
pegkiffvaidllaspke

Timeline for d3mg1a2:

• d3mg1a2 first appeared in SCOPe 2.03
  
• d3mg1a2 appears in SCOPe 2.07