Lineage for d3mfmb2 (3mfm B:263-530)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2112071Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2112072Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2113065Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2113066Protein automated matches [190246] (54 species)
    not a true protein
  7. 2113672Species Streptomyces coelicolor [TaxId:1902] [226767] (3 PDB entries)
  8. 2113684Domain d3mfmb2: 3mfm B:263-530 [213228]
    automated match to d1vrga2
    mutant

Details for d3mfmb2

PDB Entry: 3mfm (more details), 2.38 Å

PDB Description: crystal structures and mutational analyses of acyl-coa carboxylase subunit of streptomyces coelicolor
PDB Compounds: (B:) propionyl-CoA carboxylase complex B subunit

SCOPe Domain Sequences for d3mfmb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mfmb2 c.14.1.0 (B:263-530) automated matches {Streptomyces coelicolor [TaxId: 1902]}
lseppafpeeadlavtdedaeldtivpdsanqpydmhsviehvlddaeffetqplfapni
ltgfgrvegrpvgivanqpmqfagclditasekaarfvrtcdafnvpvltfvdvpgflpg
vdqehdgiirrgaklifayaeatvplitvitrkafggaynvmgskhlgadlnlawptaqi
avmgaqgavnilhrrtiadagddaeatrarliqeyedallnpytaaergyvdavimpsdt
rrhivrglrqlrtkreslppkkhgnipl

SCOPe Domain Coordinates for d3mfmb2:

Click to download the PDB-style file with coordinates for d3mfmb2.
(The format of our PDB-style files is described here.)

Timeline for d3mfmb2: