SCOPe 2.05: Domain d3mfga1: 3mfg A:4-93

Lineage for d3mfga1 (3mfg A:4-93)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)

6. Protein Toxic shock syndrome toxin-1 (TSST-1) [50224] (2 species)

7. Species Staphylococcus aureus [TaxId:158879] [224864] (1 PDB entry)

8. Domain d3mfga1: 3mfg A:4-93 [213222]
   Other proteins in same PDB: d3mfga2, d3mfgb_
   automated match to d2tssa1
   complexed with gol, so4

Details for d3mfga1

PDB Entry: 3mfg, 2.37 Å

PDB Description: Crystal structure of Toxic Shock Syndrome Toxin 1 (TSST-1) in complex with the human T cell receptor beta chain Vbeta2.1 (EP-8)

PDB Compounds: (A:) toxic shock syndrome toxin-1

SCOPe Domain Sequences for d3mfga1:

Sequence; same for both SEQRES and ATOM records:

>d3mfga1 b.40.2.2 (A:4-93) Toxic shock syndrome toxin-1 (TSST-1) {Staphylococcus aureus [TaxId: 158879]}
dnikdlldwyssgsdtftnsevldnslgsmrikntdgsisliifpspyyspaftkgekvd
lntkrtkksqhtsegtyihfqisgvtntek

Timeline for d3mfga1:

• d3mfga1 first appeared in SCOPe 2.03
  
• d3mfga1 appears in SCOPe 2.04
  
• d3mfga1 appears in SCOPe 2.06
  
• d3mfga1 appears in the current release, SCOPe 2.08