Class b: All beta proteins [48724] (177 folds) |
Fold b.74: Carbonic anhydrase [51068] (1 superfamily) single sheet; 10 strands |
Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) |
Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins) automatically mapped to Pfam PF00194 |
Protein automated matches [190681] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187805] (29 PDB entries) |
Domain d3mdza1: 3mdz A:5-262 [213211] Other proteins in same PDB: d3mdza2 automated match to d3ml5a_ complexed with ezl, gol, zn |
PDB Entry: 3mdz (more details), 2.32 Å
SCOPe Domain Sequences for d3mdza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mdza1 b.74.1.1 (A:5-262) automated matches {Human (Homo sapiens) [TaxId: 9606]} hgwgygqddgpshwhklypiaqgdrqspiniissqavyspslqplelsyeacmslsitnn ghsvqvdfndsddrtvvtggplegpyrlkqfhfhwgkkhdvgsehtvdgksfpselhlvh wnakkystfgeaasapdglavvgvfletgdehpsmnrltdalymvrfkgtkaqfscfnpk cllpasrhywtypgslttpplsesvtwivlrepiciserqmgkfrsllftsedderihmv nnfrppqplkgrvvkasf
Timeline for d3mdza1: