Lineage for d1cz8y2 (1cz8 Y:124-224)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1760578Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (6 species)
  7. 1760582Species Human (Homo sapiens) [TaxId:9606] [88575] (179 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody
  8. 1760699Domain d1cz8y2: 1cz8 Y:124-224 [21321]
    Other proteins in same PDB: d1cz8h1, d1cz8l1, d1cz8l2, d1cz8v_, d1cz8w_, d1cz8x1, d1cz8x2, d1cz8y1
    part of humanized Fab-12 neutralizing VEGF; affinity matured
    complexed with so4

Details for d1cz8y2

PDB Entry: 1cz8 (more details), 2.4 Å

PDB Description: vascular endothelial growth factor in complex with an affinity matured antibody
PDB Compounds: (Y:) heavy chain of neutralizing antibody

SCOPe Domain Sequences for d1cz8y2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cz8y2 b.1.1.2 (Y:124-224) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysls
svvtvpssslgtqtyicnvnhkpsntkvdkkvepk

SCOPe Domain Coordinates for d1cz8y2:

Click to download the PDB-style file with coordinates for d1cz8y2.
(The format of our PDB-style files is described here.)

Timeline for d1cz8y2: