SCOP 1.55: Domain d1cz8y2: 1cz8 Y:124-224

Lineage for d1cz8y2 (1cz8 Y:124-224)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)

7. Species VEGF neutralizing Fab-12 (mouse), kappa L chain [49080] (2 PDB entries)

8. Domain d1cz8y2: 1cz8 Y:124-224 [21321]
   Other proteins in same PDB: d1cz8h1, d1cz8l1, d1cz8v_, d1cz8w_, d1cz8x1, d1cz8y1

Details for d1cz8y2

PDB Entry: 1cz8, 2.4 Å

PDB Description: vascular endothelial growth factor in complex with an affinity matured antibody

SCOP Domain Sequences for d1cz8y2:

Sequence; same for both SEQRES and ATOM records:

>d1cz8y2 b.1.1.2 (Y:124-224) Immunoglobulin (constant domains of L and H chains) {VEGF neutralizing Fab-12 (mouse), kappa L chain}
astkgpsvfplapsgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysls
svvtvpssslgtqtyicnvnhkpsntkvdkkvepk

Timeline for d1cz8y2:

• d1cz8y2 appears in SCOP 1.57
  
• d1cz8y2 appears in the current release, SCOPe 2.08