SCOPe 2.04: Domain d3mckl2: 3mck L:113-219

Lineage for d3mckl2 (3mck L:113-219)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (9 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (343 PDB entries)

8. Domain d3mckl2: 3mck L:113-219 [213201]
   Other proteins in same PDB: d3mcka1, d3mckl1
   automated match to d1t66c2
   complexed with act

Details for d3mckl2

PDB Entry: 3mck, 2.3 Å

PDB Description: Crystal structure of anti-beta-amyloid antibody C705

PDB Compounds: (L:) c705 monoclonal light chain

SCOPe Domain Sequences for d3mckl2:

Sequence; same for both SEQRES and ATOM records:

>d3mckl2 b.1.1.2 (L:113-219) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d3mckl2:

• d3mckl2 first appeared in SCOPe 2.03
  
• d3mckl2 appears in SCOPe 2.05
  
• d3mckl2 appears in the current release, SCOPe 2.08