SCOPe 2.08: Domain d1cz8h2: 1cz8 H:124-224

Lineage for d1cz8h2 (1cz8 H:124-224)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (173 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody

8. Domain d1cz8h2: 1cz8 H:124-224 [21319]
   Other proteins in same PDB: d1cz8h1, d1cz8l1, d1cz8l2, d1cz8v_, d1cz8w_, d1cz8x1, d1cz8x2, d1cz8y1
   part of humanized Fab-12 neutralizing VEGF; affinity matured
   complexed with so4

Details for d1cz8h2

PDB Entry: 1cz8, 2.4 Å

PDB Description: vascular endothelial growth factor in complex with an affinity matured antibody

PDB Compounds: (H:) heavy chain of neutralizing antibody

SCOPe Domain Sequences for d1cz8h2:

Sequence, based on SEQRES records:

>d1cz8h2 b.1.1.2 (H:124-224) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

Sequence, based on observed residues (ATOM records):

>d1cz8h2 b.1.1.2 (H:124-224) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysls
svvtvpssslgtqtyicnvnhkpsntkvdkkvepk

Timeline for d1cz8h2:

• d1cz8h2 first appeared (with stable ids) in SCOP 1.55
  
• d1cz8h2 appears in SCOPe 2.07