Class b: All beta proteins [48724] (93 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species) |
Species VEGF neutralizing Fab-12 (mouse), kappa L chain [49080] (2 PDB entries) |
Domain d1cz8l2: 1cz8 L:108-213 [21318] Other proteins in same PDB: d1cz8h1, d1cz8l1, d1cz8v_, d1cz8w_, d1cz8x1, d1cz8y1 |
PDB Entry: 1cz8 (more details), 2.4 Å
SCOP Domain Sequences for d1cz8l2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cz8l2 b.1.1.2 (L:108-213) Immunoglobulin (constant domains of L and H chains) {VEGF neutralizing Fab-12 (mouse), kappa L chain} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge
Timeline for d1cz8l2: