SCOPe 2.05: Domain d3macl2: 3mac L:110-211

Lineage for d3macl2 (3mac L:110-211)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)

8. Domain d3macl2: 3mac L:110-211 [213167]
   automated match to d1h0da2

Details for d3macl2

PDB Entry: 3mac, 2.5 Å

PDB Description: crystal structure of gp41-derived protein complexed with fab 8062

PDB Compounds: (L:) Fab8062

SCOPe Domain Sequences for d3macl2:

Sequence; same for both SEQRES and ATOM records:

>d3macl2 b.1.1.0 (L:110-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapt

Timeline for d3macl2:

• d3macl2 first appeared in SCOPe 2.03
  
• d3macl2 appears in SCOPe 2.04
  
• d3macl2 appears in SCOPe 2.06
  
• d3macl2 appears in the current release, SCOPe 2.08