SCOPe 2.08: Domain d3ma9l1: 3ma9 L:2-109

Lineage for d3ma9l1 (3ma9 L:2-109)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d3ma9l1: 3ma9 L:2-109 [213164]
   automated match to d1h0da1
   complexed with na

Details for d3ma9l1

PDB Entry: 3ma9, 2.05 Å

PDB Description: crystal structure of gp41 derived protein complexed with fab 8066

PDB Compounds: (L:) Fab8066 FAB ANTIBODY FRAGMENT, Light Chain

SCOPe Domain Sequences for d3ma9l1:

Sequence; same for both SEQRES and ATOM records:

>d3ma9l1 b.1.1.0 (L:2-109) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ieltqppsvsvvpgqtariscsgdnipyeyaswyqqkpgqapvlviygdnnrpsgiperf
sgsnsgntatltisgtqaedeadyycaswdsmtvdgvfgggtkltvlg

Timeline for d3ma9l1:

• d3ma9l1 first appeared in SCOPe 2.03
  
• d3ma9l1 appears in SCOPe 2.07