Lineage for d1bj1j2 (1bj1 J:108-213)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1761687Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)
  7. 1761688Species Human (Homo sapiens) [TaxId:9606] [88569] (144 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody
  8. 1761761Domain d1bj1j2: 1bj1 J:108-213 [21316]
    Other proteins in same PDB: d1bj1h1, d1bj1h2, d1bj1j1, d1bj1k1, d1bj1k2, d1bj1l1, d1bj1v_, d1bj1w_
    part of humanized Fab-12 neutralizing VEGF
    complexed with so4

Details for d1bj1j2

PDB Entry: 1bj1 (more details), 2.4 Å

PDB Description: vascular endothelial growth factor in complex with a neutralizing antibody
PDB Compounds: (J:) fab fragment

SCOPe Domain Sequences for d1bj1j2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bj1j2 b.1.1.2 (J:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d1bj1j2:

Click to download the PDB-style file with coordinates for d1bj1j2.
(The format of our PDB-style files is described here.)

Timeline for d1bj1j2: