SCOPe 2.04: Domain d1bj1j2: 1bj1 J:108-213

Lineage for d1bj1j2 (1bj1 J:108-213)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88569] (144 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody

8. Domain d1bj1j2: 1bj1 J:108-213 [21316]
   Other proteins in same PDB: d1bj1h1, d1bj1h2, d1bj1j1, d1bj1k1, d1bj1k2, d1bj1l1, d1bj1v_, d1bj1w_
   part of humanized Fab-12 neutralizing VEGF
   complexed with so4

Details for d1bj1j2

PDB Entry: 1bj1, 2.4 Å

PDB Description: vascular endothelial growth factor in complex with a neutralizing antibody

PDB Compounds: (J:) fab fragment

SCOPe Domain Sequences for d1bj1j2:

Sequence; same for both SEQRES and ATOM records:

>d1bj1j2 b.1.1.2 (J:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d1bj1j2:

• d1bj1j2 first appeared (with stable ids) in SCOP 1.55
  
• d1bj1j2 appears in SCOPe 2.03
  
• d1bj1j2 appears in SCOPe 2.05
  
• d1bj1j2 appears in the current release, SCOPe 2.08