SCOPe 2.06: Domain d3m8va_: 3m8v A:

Lineage for d3m8va_ (3m8v A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (3 families)

5. Family d.42.1.0: automated matches [191460] (1 protein)
   not a true family

6. Protein automated matches [190710] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187857] (39 PDB entries)

8. Domain d3m8va_: 3m8v A: [213159]
   automated match to d3m4ta_

Details for d3m8va_

PDB Entry: 3m8v, 2.7 Å

PDB Description: crystal structure of the btb domain from kaiso/zbtb33, form ii

PDB Compounds: (A:) Transcriptional regulator Kaiso

SCOPe Domain Sequences for d3m8va_:

Sequence; same for both SEQRES and ATOM records:

>d3m8va_ d.42.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rklisatdiqysgsllnslneqrghglfcdvtvivedrkfrahknilsasstyfhqlfsv
agqvvelsfiraeifaeilnyiysskivrvrsdlldeliksgqllgvkfiaelg

Timeline for d3m8va_:

• d3m8va_ first appeared in SCOPe 2.03
  
• d3m8va_ appears in SCOPe 2.05
  
• d3m8va_ appears in SCOPe 2.07
  
• d3m8va_ appears in the current release, SCOPe 2.08