SCOPe 2.04: Domain d3m7nh1: 3m7n H:2-178

Lineage for d3m7nh1 (3m7n H:2-178)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.4: Ribonuclease PH domain 1-like [54229] (11 proteins)

6. Protein Exosome complex exonuclease 2,ECX2 [159920] (2 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [159921] (4 PDB entries)
   Uniprot O29756 3-178

8. Domain d3m7nh1: 3m7n H:2-178 [213141]
   Other proteins in same PDB: d3m7nd1, d3m7nd2, d3m7ne1, d3m7ne2, d3m7nf1, d3m7nf2, d3m7ng2, d3m7nh2, d3m7ni2
   automated match to d2ba0g1
   protein/RNA complex; complexed with zn

Details for d3m7nh1

PDB Entry: 3m7n, 2.4 Å

PDB Description: archaeoglobus fulgidus exosome with rna bound to the active site

PDB Compounds: (H:) probable exosome complex exonuclease 2

SCOPe Domain Sequences for d3m7nh1:

Sequence; same for both SEQRES and ATOM records:

>d3m7nh1 d.14.1.4 (H:2-178) Exosome complex exonuclease 2,ECX2 {Archaeoglobus fulgidus [TaxId: 2234]}
pedilvdikrdyvlsklrdneridgrgfdefrkveiipnviekaegsalvklgdtqvvvg
vkmqpgepypdtpdrgviivnaelvplasptfepgppdensielarvvdrgireseavdl
sklvieegekvwivfvdihaldddgnlldasalaaiaalmntkvpaerfdlgedyll

Timeline for d3m7nh1:

• d3m7nh1 first appeared in SCOPe 2.03
  
• d3m7nh1 appears in SCOPe 2.05
  
• d3m7nh1 appears in the current release, SCOPe 2.08