Class b: All beta proteins [48724] (93 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species) |
Species VEGF neutralizing Fab-12 (mouse), kappa L chain [49080] (2 PDB entries) |
Domain d1bj1l2: 1bj1 L:108-213 [21314] Other proteins in same PDB: d1bj1h1, d1bj1j1, d1bj1k1, d1bj1l1, d1bj1v_, d1bj1w_ |
PDB Entry: 1bj1 (more details), 2.4 Å
SCOP Domain Sequences for d1bj1l2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bj1l2 b.1.1.2 (L:108-213) Immunoglobulin (constant domains of L and H chains) {VEGF neutralizing Fab-12 (mouse), kappa L chain} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge
Timeline for d1bj1l2: