Lineage for d3m2wa_ (3m2w A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1929110Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1929111Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1929232Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1930786Protein MAP kinase activated protein kinase 2, mapkap2 [82789] (1 species)
    CaMK group; MAPKAPK subfamily; serine/threonine kinase
  7. 1930787Species Human (Homo sapiens) [TaxId:9606] [82790] (15 PDB entries)
  8. 1930788Domain d3m2wa_: 3m2w A: [213120]
    automated match to d1nxkc_
    complexed with l8i, mg

Details for d3m2wa_

PDB Entry: 3m2w (more details), 2.41 Å

PDB Description: crystal structure of mapkak kinase 2 (mk2) complexed with a spiroazetidine-tetracyclic atp site inhibitor
PDB Compounds: (A:) MAP kinase-activated protein kinase 2

SCOPe Domain Sequences for d3m2wa_:

Sequence, based on SEQRES records: (download)

>d3m2wa_ d.144.1.7 (A:) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]}
hvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarreve
lhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqaftereasei
mksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettgekydkscdmw
slgvimyillcgyppfysnhglaispgmktrirmgqyefpnpewsevseevkmlirnllk
teptqrmtitefmnhpwimqstkvpqtplhtsrvlkedkerwedvkeemtsalatmr

Sequence, based on observed residues (ATOM records): (download)

>d3m2wa_ d.144.1.7 (A:) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]}
hvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarreve
lhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqaftereasei
mksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettgekydkscdmw
slgvimyillcgyppfyspgmktrirmgqyefpnpewsevseevkmlirnllkteptqrm
titefmnhpwimqstkvpqtplhtsrvlkedkerwedvkeemtsalatmr

SCOPe Domain Coordinates for d3m2wa_:

Click to download the PDB-style file with coordinates for d3m2wa_.
(The format of our PDB-style files is described here.)

Timeline for d3m2wa_: