Class b: All beta proteins [48724] (104 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species) |
Species Antibody to CAMPATH-1H humanized fab, kappa L chain [49079] (1 PDB entry) |
Domain d1beyl2: 1bey L:108-214 [21312] Other proteins in same PDB: d1beyh1, d1beyl1 |
PDB Entry: 1bey (more details), 3.25 Å
SCOP Domain Sequences for d1beyl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1beyl2 b.1.1.2 (L:108-214) Immunoglobulin (constant domains of L and H chains) {Antibody to CAMPATH-1H humanized fab, kappa L chain} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec
Timeline for d1beyl2: