SCOPe 2.03: Domain d1ce1h2: 1ce1 H:122-220

Lineage for d1ce1h2 (1ce1 H:122-220)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (6 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (177 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody

8. Domain d1ce1h2: 1ce1 H:122-220 [21311]
   Other proteins in same PDB: d1ce1h1, d1ce1l1, d1ce1l2
   part of humanized therapeutic antibody CAMPATH-1H

Details for d1ce1h2

PDB Entry: 1ce1, 1.9 Å

PDB Description: 1.9a structure of the therapeutic antibody campath-1h fab in complex with a synthetic peptide antigen

PDB Compounds: (H:) protein (campath-1h:heavy chain)

SCOPe Domain Sequences for d1ce1h2:

Sequence; same for both SEQRES and ATOM records:

>d1ce1h2 b.1.1.2 (H:122-220) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkve

Timeline for d1ce1h2:

• d1ce1h2 first appeared (with stable ids) in SCOP 1.55
  
• d1ce1h2 appears in SCOPe 2.02
  
• d1ce1h2 appears in SCOPe 2.04
  
• d1ce1h2 appears in the current release, SCOPe 2.08